Contact Information
Phone
(386) 873-4560Website
serenitywellnessfamilypractice.com
About
Serenity Wellness and Family Practice provides personalized functional wellness in DeLand, FL, focusing on treating the whole person. Led by Michelle Tutt, APRN, the practice stands out with its integrative approach, offering services like hormone therapy, IV therapy, and advanced body contouring to address root causes for long-term health.
Is this your clinic? Verify & Upgrade
Hyperlinked URL, clickable social links, top placement, and a verified badge across bioEDGE. $15/month or $99/year.
Nearby Clinics in DeLand
5 clinics in DeLand
A Younger You Med Spa|DeLand, FL|(386) 202-1401
Anti-Aging Clinic
PRP Therapy
Family Integrative Medicine|DeLand, FL|(407) 751-2192
Alternative Medicine
Functional Medicine
Naturopath
Infinite MedSpa & Wellness|DeLand, FL|(386) 956-0131
PRP Therapy
N. Harmony Functional Medicine Clinic|DeLand, FL|(386) 287-2755
Alternative Medicine
Functional Medicine
Naturopath
REV Physical Therapy and Sports Medicine|DeLand, FL|(386) 738-3456
Peptide Therapy

